CF1761353216167-tsm20251024211356

DNSWHOIS.INFO - dayzairfield.weebly.com

Search for IP or hostnames:

dayzairfield.weebly.com checked at 2025-10-25T00:46:56.154Z 68ms 34/34/34 100% R:7

dayzairfield.weebly.com

A74.115.51.8🇺🇸 WEEBLY
PTRwildcard.weebly.com
A74.115.51.9🇺🇸 WEEBLY
PTRwildcard.weebly.com

weebly.com

NSns-123.awsdns-15.com
MXaspmx2.googlemail.com
MXaspmx3.googlemail.com
NSns-646.awsdns-16.net
NSns-1500.awsdns-59.org
MXaspmx.l.google.com
NSns-1797.awsdns-32.co.uk
MXalt1.aspmx.l.google.com
MXalt2.aspmx.l.google.com
A74.115.51.6🇺🇸 WEEBLY
A74.115.51.7🇺🇸 WEEBLY
rank #94 globally
rank #64 in the tld
This domain, "weebly.com", is the official website for Weebly, a platform that provides tools for users to create free websites, blogs, or online stores. It's a popular platform used by individuals, businesses, and organizations to build and manage their online presence. The site offers customizable design templates, eCommerce tools, and marketing features. The service is known for its user-friendly interface, making it easy for anyone to create a professional-looking website.

AI analysis

dayzairfield.weebly.com resolves to two IP numbers: 74.115.51.8 and 74.115.51.9.

Other host names, for instance forfait-internet.weebly.com, softmill.weebly.com, kidkraftkitchenkidkraftplaykitch.weebly.com, japan.wildcaveman.weebly.com and facingclassism.weebly.com share IP numbers with dayzairfield.weebly.com.

Perform reverse DNS lookup as well as normal forward DNS. Check Autonomous System Numbers (ASNs) and BGP connections between Internet Service Providers.
dbq

eafquXj CF johedugfp 2025-10-25