DNSWHOIS.INFO - plokkersheem.weebly.com
Search for IP or hostnames:
plokkersheem.weebly.com checked at 2025-11-01T20:09:00.968Z 53ms 34/34/34 100% R:9plokkersheem.weebly.com
| A | 74.115.51.8🇺🇸 WEEBLY | ||||||
| PTR | wildcard.weebly.com | ||||||
| A | 74.115.51.9🇺🇸 WEEBLY | ||||||
| PTR | wildcard.weebly.com | ||||||
weebly.com
rank #64 in the tld
This domain, "weebly.com", is the official website for Weebly, a platform that provides tools for users to create free websites, blogs, or online stores. It's a popular platform used by individuals, businesses, and organizations to build and manage their online presence. The site offers customizable design templates, eCommerce tools, and marketing features. The service is known for its user-friendly interface, making it easy for anyone to create a professional-looking website.
AI analysis
plokkersheem.weebly.com points to two IP numbers: 74.115.51.8 and 74.115.51.9.
Other host names such as forfait-internet.weebly.com, softmill.weebly.com, kidkraftkitchenkidkraftplaykitch.weebly.com, japan.wildcaveman.weebly.com and facingclassism.weebly.com share IP numbers with plokkersheem.weebly.com.
dbq